Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 4 (FGF4), partial (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

Abbreviation

Recombinant Human FGF4 protein, partial (Active)

Gene Name

FGF4

UniProt

P08620

Expression Region

54-206aa

Organism

Homo sapiens (Human)

Target Sequence

SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Fibroblast growth factor 4 (FGF-4) is a heparin binding member of the FGF family. The human FGF4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature human FGF4 shares 91%, 82%, 94% and 91% aa identity with mouse, rat, canine and bovine FGF4, respectively. Human FGF-4 has been shown to exhibit cross species activity. Expression of FGF-4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell selfrenewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Complement Component 7 ELISA kit
GTR10437373 96 Well

Canine Complement Component 7 ELISA kit

Sign In for Pricing
View Details
NPAS2 Antibody
28-810 100 µL

NPAS2 Antibody

Sign In for Pricing
View Details
Anti-ADCY9 Polyclonal Antibody
PHA93001 100 μg

Anti-ADCY9 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)
MBS965466-01 0.02 mg (E-Coli)

Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)

Sign In for Pricing
View Details
Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)
MBS965466-02 0.1 mg (E-Coli)

Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)

Sign In for Pricing
View Details
Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)
MBS965466-03 0.02 mg (Yeast)

Recombinant Mouse Small nuclear ribonucleoprotein F (Snrpf)

Sign In for Pricing
View Details