Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 4 (FGF4), partial (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

Abbreviation

Recombinant Human FGF4 protein, partial (Active)

Gene Name

FGF4

UniProt

P08620

Expression Region

54-206aa

Organism

Homo sapiens (Human)

Target Sequence

SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Fibroblast growth factor 4 (FGF-4) is a heparin binding member of the FGF family. The human FGF4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature human FGF4 shares 91%, 82%, 94% and 91% aa identity with mouse, rat, canine and bovine FGF4, respectively. Human FGF-4 has been shown to exhibit cross species activity. Expression of FGF-4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell selfrenewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit
MBS7238099-01 48 Well

Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit

Sign In for Pricing
View Details
Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit
MBS7238099-02 96 Well

Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit

Sign In for Pricing
View Details
Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit
MBS7238099-03 5x 96 Well

Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit

Sign In for Pricing
View Details
Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit
MBS7238099-04 10x 96 Well

Goat Beta-lactamase-like protein 2 (LACTB2) ELISA Kit

Sign In for Pricing
View Details
Mouse Arhgap45 qPCR Primer Pair
QM39090S 200 Tests

Mouse Arhgap45 qPCR Primer Pair

Sign In for Pricing
View Details
NELL1 Rabbit pAb
A3313 200 µL

NELL1 Rabbit pAb

Sign In for Pricing
View Details