Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial (Active)

Product Specifications

Product Name Alternative

Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4

Abbreviation

Recombinant Mouse Ctla4 protein, partial (Active)

Gene Name

Ctla4

UniProt

P09793

Expression Region

37-161aa

Organism

Mus musculus (Mouse)

Target Sequence

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Mouse Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus (SLE), Gravesdisease (GRD), Celiac disease type3 (CELIAC3) and Hepatitis B virus infection (HBVinfection) .

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse B7-1-Fc at 5μg/ml can bind Mouse CTLA-4-His, the ED50 of Recombinant Mouse CTLA-4-His is 2-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH-CMV-CNTNAP3EF1A-EGFP-T2A-PURO
BZ0488-2 1 Vial

PCDH-CMV-CNTNAP3EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
6-Benzyloxyindole
TRC-B285945-50MG 50 mg

6-Benzyloxyindole

Sign In for Pricing
View Details
Recombinant Human KRT4 Protein, N-His
orb2833478-01 20 µg

Recombinant Human KRT4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT4 Protein, N-His
orb2833478-02 50 µg

Recombinant Human KRT4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT4 Protein, N-His
orb2833478-03 100 µg

Recombinant Human KRT4 Protein, N-His

Sign In for Pricing
View Details
Guinea Pig Centrin 1 (CETN1) ELISA kit
GTR10428888 96 Well

Guinea Pig Centrin 1 (CETN1) ELISA kit

Sign In for Pricing
View Details