Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Mouse (His)

The 15-PGDH/HPGD protein catalyzes the NAD-dependent dehydrogenation of various hydroxylated polyunsaturated fatty acids (mainly eicosanoids and behenic acid) . 15-PGDH/HPGD Protein, Mouse (His) is the recombinant mouse-derived 15-PGDH/HPGD protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-mouse-his.html

Purity

98.00

Smiles

MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS

Molecular Formula

15446 (Gene_ID) Q8VCC1 (M1-S269) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AGER Rabbit pAb
E2501395 100 µL

AGER Rabbit pAb

Ask
View Details
RUNX1, phosphorylated (S435) discontinued
340856-01 100 µL

RUNX1, phosphorylated (S435) discontinued

Ask
View Details
RUNX1, phosphorylated (S435) discontinued
340856-02 200 µL

RUNX1, phosphorylated (S435) discontinued

Ask
View Details
TBL1X Adenovirus (Human)
46285051 1.0 mL

TBL1X Adenovirus (Human)

Ask
View Details
Mouse Monoclonal Serpin B3/SCCA1 Antibody (OTI3C2) - Azide and BSA Free
NBP2-74108 100 µg

Mouse Monoclonal Serpin B3/SCCA1 Antibody (OTI3C2) - Azide and BSA Free

Ask
View Details
MUC1 (EMA, CD227, Breast carcinoma-associated antigen DF3, CA15-3, Carcinoma-associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface associated, Mucin-1 subunit beta, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin, PUM, Tumor-associated epithelial membrane antigen, Tumor-associated mucin) (BSA & Azide Free)
168835-AF 100 µg

MUC1 (EMA, CD227, Breast carcinoma-associated antigen DF3, CA15-3, Carcinoma-associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface associated, Mucin-1 subunit beta, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin, PUM, Tumor-associated epithelial membrane antigen, Tumor-associated mucin) (BSA & Azide Free)

Ask
View Details