Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-1, Canine (HEK293, His)

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-1 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-1-protein-canine-hek293-his.html

Purity

97.00

Smiles

TPQPWHCAPCTPEKLALCPPVPASCAETALPAGCGCCPMCALPQDAPCGVATARCATGLSCRAAPGEERPLHALIRGRGVCVPTDPAADAKESSESSEITQEQLLENFHLMVPSEEDTPILWNAVRNYKTVRSDDSDKLKEPCRRELHEVLARLAEEQASRQLYSFYLPNCNKNGFYHSRQCKTAMDGQRGLCWCVYPWNGERIPGSVEVRGDPNCGQYFTGHS

Molecular Formula

480812 (Gene_ID) A0A8I3NJH1/XP_005629556.1 (T26-S249) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-500 1x 500 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF405S conjugate, 0.1mg/mL
BNC040889-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF647 conjugate, 0.1mg/mL
BNC470014-500 1x 500 µL

CD31 / PECAM-1 (C31.7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details