Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (His)

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (His) is the recombinant human-derived FGF-19 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-his.html

Purity

95.0

Smiles

FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (F27-K216) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Rab GDP dissociation inhibitor alpha ELISA Kit
MBS2884876-01 48 Well

Mouse Rab GDP dissociation inhibitor alpha ELISA Kit

Ask
View Details
Mouse Rab GDP dissociation inhibitor alpha ELISA Kit
MBS2884876-02 96 Well

Mouse Rab GDP dissociation inhibitor alpha ELISA Kit

Ask
View Details
Mouse Rab GDP dissociation inhibitor alpha ELISA Kit
MBS2884876-03 5x 96 Well

Mouse Rab GDP dissociation inhibitor alpha ELISA Kit

Ask
View Details
Mouse Rab GDP dissociation inhibitor alpha ELISA Kit
MBS2884876-04 10x 96 Well

Mouse Rab GDP dissociation inhibitor alpha ELISA Kit

Ask
View Details
PP frame for 30mm diameter zinc filling bottles, (Grid 3 x 8)
1213894 1 PC

PP frame for 30mm diameter zinc filling bottles, (Grid 3 x 8)

Ask
View Details
Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [DyLight 680]
NBP2-42656FR 100 µL

Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [DyLight 680]

Ask
View Details