Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (His)

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (His) is the recombinant human-derived FGF-19 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-his.html

Purity

95.0

Smiles

FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (F27-K216) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pig Protein Plunc, PLUNC ELISA Kit
MBS9327563-01 48 Well

Pig Protein Plunc, PLUNC ELISA Kit

Ask
View Details
Pig Protein Plunc, PLUNC ELISA Kit
MBS9327563-02 96 Well

Pig Protein Plunc, PLUNC ELISA Kit

Ask
View Details
Pig Protein Plunc, PLUNC ELISA Kit
MBS9327563-03 5x 96 Well

Pig Protein Plunc, PLUNC ELISA Kit

Ask
View Details
Pig Protein Plunc, PLUNC ELISA Kit
MBS9327563-04 10x 96 Well

Pig Protein Plunc, PLUNC ELISA Kit

Ask
View Details
YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog) (PE)
MBS6398875-01 0.1 mL

YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog) (PE)

Ask
View Details
YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog) (PE)
MBS6398875-02 5x 0.1 mL

YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog) (PE)

Ask
View Details