Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (His)

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (His) is the recombinant human-derived FGF-19 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-his.html

Purity

95.0

Smiles

FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (F27-K216) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human NUDT22 qPCR Primer Pair
QH55733S 200 Tests

Human NUDT22 qPCR Primer Pair

Ask
View Details
COLEC11 (NM_001255983) Human Tagged ORF Clone
RG232271 10 µg

COLEC11 (NM_001255983) Human Tagged ORF Clone

Ask
View Details
Brilliant Violet 421™ anti-mouse CD163
GT05615 50 µg

Brilliant Violet 421™ anti-mouse CD163

Ask
View Details
Saliva RNA Collection and Preservation Devices Dx
53800 50 Units

Saliva RNA Collection and Preservation Devices Dx

Ask
View Details
JNK1/2/3 (JNK 46, JNK 55, JNK, JNK1, JNK1A2, JNK2, JNK21B1/2, JNK2ALPHA, JNK2B, JNK2BETA, JNK3, JNK3A, MAP Kinase 8, MAP Kinase 9, MAP Kinase p49 3F12, MAPK 8, MAPK 9, MAPK10, MAPK8, MAPK9, MGC50974, Mitogen Activated Protein Kinase 10, Mitogen Activated Protein Kinase 8, Mitogen Activated Protein Kinase 9) discontinued
223750-01 50 µL

JNK1/2/3 (JNK 46, JNK 55, JNK, JNK1, JNK1A2, JNK2, JNK21B1/2, JNK2ALPHA, JNK2B, JNK2BETA, JNK3, JNK3A, MAP Kinase 8, MAP Kinase 9, MAP Kinase p49 3F12, MAPK 8, MAPK 9, MAPK10, MAPK8, MAPK9, MGC50974, Mitogen Activated Protein Kinase 10, Mitogen Activated Protein Kinase 8, Mitogen Activated Protein Kinase 9) discontinued

Ask
View Details
JNK1/2/3 (JNK 46, JNK 55, JNK, JNK1, JNK1A2, JNK2, JNK21B1/2, JNK2ALPHA, JNK2B, JNK2BETA, JNK3, JNK3A, MAP Kinase 8, MAP Kinase 9, MAP Kinase p49 3F12, MAPK 8, MAPK 9, MAPK10, MAPK8, MAPK9, MGC50974, Mitogen Activated Protein Kinase 10, Mitogen Activated Protein Kinase 8, Mitogen Activated Protein Kinase 9) discontinued
223750-02 100 µL

JNK1/2/3 (JNK 46, JNK 55, JNK, JNK1, JNK1A2, JNK2, JNK21B1/2, JNK2ALPHA, JNK2B, JNK2BETA, JNK3, JNK3A, MAP Kinase 8, MAP Kinase 9, MAP Kinase p49 3F12, MAPK 8, MAPK 9, MAPK10, MAPK8, MAPK9, MGC50974, Mitogen Activated Protein Kinase 10, Mitogen Activated Protein Kinase 8, Mitogen Activated Protein Kinase 9) discontinued

Ask
View Details