Question 1

What is the catalog number for GLP-1 Peptide?

Accepted Answer

The catalog number for GLP-1 Peptide is orb1516200.

Question 2

What sizes are available for GLP-1 Peptide?

Accepted Answer

GLP-1 Peptide is available in the following size(s): 100 µg, 500 µg, 1 mg.

Question 3

How many pack sizes does GLP-1 Peptide come in?

Accepted Answer

GLP-1 Peptide is available in 3 different pack sizes.

Question 4

Is GLP-1 Peptide in stock?

Accepted Answer

GLP-1 Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is GLP-1 Peptide used for?

Accepted Answer

This product is GLP-1 Peptide. Its protein sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2. Purified using HPLC.

Question 6

What expression system was used for this recombinant protein?

Accepted Answer

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Question 7

Can I return this product if I ordered the wrong one?

Accepted Answer

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Question 8

Is this product tested for endotoxin levels?

Accepted Answer

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

GLP-1 Peptide

Product Specifications

Product Name Alternative

Form

Storage Conditions

Notes

AA Sequence

Available Sizes

Frequently Asked Questions

Explore Other Products

Rad21 Peptide - N-terminal region

TRMT13 siRNA (Human)

TRMT13 siRNA (Human)

Mouse Gingival Epithelial Cell Complete Medium

Mouse Gingival Epithelial Cell Complete Medium

Mouse Frizzled Homolog 1 (FZD1) Antibody Pair Kit (with Standard)