Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS2, Human (His, T7)

BCAS2 Protein, Human (His, T7) plays crucial roles in pre-mRNA splicing and androgen receptor transcription. BCAS2 helps repair radiation-induced DSBs efficiently in both human PCa cells and Drosophila[1][2].

Product Specifications

Product Name Alternative

BCAS2 Protein, Human (His, T7), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcas2-protein-human-his-t7.html

Purity

97.00

Smiles

ASMTGGQQMGAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Molecular Formula

10286 (Gene_ID) O75934 (A2-F225) (Accession)

Molecular Weight

Approximately 28 kDa

References & Citations

[1]Li-Po Wang, et al. BCAS2, a protein enriched in advanced prostate cancer, interacts with NBS1 to enhance DNA double-strand break repair. Br J Cancer. 2020 Dec;123 (12) :1796-1807.|[2]Ángel Salmerón-Hernández, et al. BCAS2 Enhances Carcinogenic Effects of Estrogen Receptor Alpha in Breast Cancer Cells. Int J Mol Sci. 2019 Feb 22;20 (4) :966.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMTA1-IT1 Protein Vector (Human) (pPB-N-His)
PV067338 500 ng

CAMTA1-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SlmA Antibody
orb832273 2 mg

SlmA Antibody

Sign In for Pricing
View Details
Recombinant Human Thrombopoietin CF
288-TP-025/CF 25 µg

Recombinant Human Thrombopoietin CF

Sign In for Pricing
View Details
Ksr2 Rabbit pAb
E2370144 100 µL

Ksr2 Rabbit pAb

Sign In for Pricing
View Details
Spermidine
C09422 100 mg

Spermidine

Sign In for Pricing
View Details
Syncollin (SYCN), Recombinant, Human, His-Tag, GST-Tag
055108-01 10 µg

Syncollin (SYCN), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details