Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAPL2/GATE-16, Human (His)

GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GABARAPL2/GATE-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabarapl2-gate-16-protein-human-his.html

Purity

95.90

Smiles

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Molecular Formula

11345 (Gene_ID) P60520 (M1-F117) (Accession)

Molecular Weight

Approximately 15 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCAA1 Double Nickase Plasmid (h2)
sc-412242-NIC-2 20 µg

BRCAA1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
CYP11B2 Recombinant Rabbit mAb
orb2326100-01 25 µL

CYP11B2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CYP11B2 Recombinant Rabbit mAb
orb2326100-02 50 µL

CYP11B2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CYP11B2 Recombinant Rabbit mAb
orb2326100-03 100 µL

CYP11B2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
WNT7B ELISA Kit (Chicken) (OKEH08611)
OKEH08611 96 Well

WNT7B ELISA Kit (Chicken) (OKEH08611)

Sign In for Pricing
View Details
IL-1RII (G-5) Alexa Fluor® 647
sc-376247 AF647 200 µg/mL

IL-1RII (G-5) Alexa Fluor® 647

Sign In for Pricing
View Details