Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 18 (TNFSF18), partial (Active)

Product Specifications

Abbreviation

Recombinant Human TNFSF18 protein, partial (Active)

Gene Name

TNFSF18

UniProt

Q9UNG2

Expression Region

72-199aa

Organism

Homo sapiens (Human)

Target Sequence

QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Tag

N-terminal hFc-Flag-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRICH2 siRNA Oligos set (Human)
38272171 3x 5 nmol

QRICH2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Parathion discontinued
P3108-10 1 mL

Parathion discontinued

Sign In for Pricing
View Details
Lentiviral mouse Wnt5a shRNA (UAS) - Lentiviral mouse Wnt5a shRNA (UAS, RFP) plasmid
GTR15228589 1 Vial

Lentiviral mouse Wnt5a shRNA (UAS) - Lentiviral mouse Wnt5a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal EDF1 Antibody [Alexa Fluor 488]
NBP2-22327AF488 0.1 mL

Rabbit Polyclonal EDF1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Human CXCL11/I-TAC Protein, N-GST
E55P0216 50 µg

Recombinant Human CXCL11/I-TAC Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human ILKAP Protein, His-SUMO, E.coli-100ug
QP6230-ec-100ug 100ug

Recombinant Human ILKAP Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details