Carbonic Anhydrase 11, Human (HEK293, His)
Carbonic Anhydrase 11 Protein, Human (HEK293, His) is an approximately 38.0 kDa carbonic anhydrase 11 protein with a His-flag. Carbonic anhydrases (CAs) are found in many organisms, in which they contribute to several important biological processes[1].
Product Specifications
Product Name Alternative
Carbonic Anhydrase 11 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-11-protein-human-hek293-his.html
Purity
98.0
Smiles
HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRHHHHHH
Molecular Formula
770 (Gene_ID) O75493 (V64-R328) (Accession)
Molecular Weight
Approximately 38.0 kDa
References & Citations
[1]J A Loncaster, et al. Carbonic anhydrase (CA IX) expression, a potential new intrinsic marker of hypoxia: correlations with tumor oxygen measurements and prognosis in locally advanced carcinoma of the cervix. Cancer Res. 2001 Sep 1;61 (17) :6394-9.|[2]K Taniuchi, et al. Developmental expression of carbonic anhydrase-related proteins VIII, X, and XI in the human brain. Neuroscience. 2002;112 (1) :93-9.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6339507-01 0.2 mL
RAB10, ID (RAB10, Ras-related protein Rab-10) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6339507-02 5x 0.2 mL
RAB10, ID (RAB10, Ras-related protein Rab-10) (Azide free) (HRP)
Sign In for Pricing
View Details