Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 beta/CCL19, Mouse

MIP-3 beta/CCL19 Protein, Mouse is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse is a recombinant mouse MIP-3 beta/CCL19 (G26-S108) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MIP-3 beta/CCL19 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-beta-ccl19-protein-mouse.html

Purity

97.00

Smiles

GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Molecular Formula

24047 (Gene_ID) O70460 (G26-S108) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang X, et al. Increased CCL19 expression is associated with progression in cervical cancer. Oncotarget. 2017 May 18;8 (43) :73817-73825.|[2]Yan Yan, et al. CCL19 and CCR7 Expression, Signaling Pathways, and Adjuvant Functions in Viral Infection and Prevention. Front Cell Dev Biol. 2019 Oct 1;7:212.|[3]Naomi Yamashita, et al. Role of CCL21 and CCL19 in allergic inflammation in the ovalbumin-specific murine asthmatic model. J Allergy Clin Immunol. 2006 May;117 (5) :1040-6|[4]Benjamin J Marsland, et al. CCL19 and CCL21 induce a potent proinflammatory differentiation program in licensed dendritic cells. Immunity. 2005 Apr;22 (4) :493-505.|[5]Yan Yan, et al. CCL19 enhances CD8+ T-cell responses and accelerates HBV clearance. J Gastroenterol. 2021 Aug;56 (8) :769-785.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BFAR discontinued
386435 200 µL

BFAR discontinued

Sign In for Pricing
View Details
Recombinant Shigella Sonnei katG Protein (aa 1-726)
VAng-Lsx09805-inquire Inquire

Recombinant Shigella Sonnei katG Protein (aa 1-726)

Sign In for Pricing
View Details
ALAS2 Human Gene Knockout Kit (CRISPR)
KN406567 1 Kit

ALAS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PECAM-1 (H-3) AC
sc-376764 AC 500 µg/mL - 25% ag

PECAM-1 (H-3) AC

Sign In for Pricing
View Details
AOCS CRM Cotton BASF Agricultural Solutions Seed US LLC Non modified 10 micrograms leaf DNA
0306-A3 10 µg

AOCS CRM Cotton BASF Agricultural Solutions Seed US LLC Non modified 10 micrograms leaf DNA

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Over-expression Lysate
LS006351 100 µg

Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Over-expression Lysate

Sign In for Pricing
View Details