Question 1

What is the catalog number for GRP Antibody Blocking Peptide?

Accepted Answer

The catalog number for GRP Antibody Blocking Peptide is orb1512423.

Question 2

What sizes are available for GRP Antibody Blocking Peptide?

Accepted Answer

GRP Antibody Blocking Peptide is available in the following size(s): 500 µg.

Question 3

Is GRP Antibody Blocking Peptide in stock?

Accepted Answer

GRP Antibody Blocking Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What is GRP Antibody Blocking Peptide used for?

Accepted Answer

This product is GRP Antibody Blocking Peptide. Its protein sequence is APVSTGAGGGTVLAKMYPRGSHWAVGHLM-NH2. Targets Gastrin-releasing peptide. Purified using HPLC.

Question 5

What happens if this product doesn’t perform as expected in my experiment?

Accepted Answer

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Question 6

Is this product classed as hazardous or restricted for shipping?

Accepted Answer

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Question 7

Can you help me confirm if this product is right for my specific experiment?

Accepted Answer

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

GRP Antibody Blocking Peptide

Product Specifications

Product Name Alternative

Form

Storage Conditions

Notes

AA Sequence

Frequently Asked Questions

Explore Other Products

2-Hydroxyisobutyryl-Histone H3 (Lys14) Recombinant Rabbit mAb Antibody

CST4 Protein Vector (Human) (pPM-C-His)

Anti-GALNT11 Antibody Picoband® Biotin Conjugated

GATA2 (GATA Binding Factor 2, LJ45948, MGC2306, NFE1B) (HRP)

GATA2 (GATA Binding Factor 2, LJ45948, MGC2306, NFE1B) (HRP)

Diisodecyl Phthalate-d4