Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K)

Product Specifications

Product Name Alternative

(RNA polymerase III subunit C10) (DNA-directed RNA polymerase III subunit K) (RNA polymerase III 12.5 kDa subunit) (RPC12.5) (RNA polymerase III subunit C11) (HsC11p) (RPC11) (hRPC11)

Abbreviation

Recombinant Human POLR3K protein

Gene Name

POLR3K

UniProt

Q9Y2Y1

Expression Region

1-108aa

Organism

Homo sapiens (Human)

Target Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Tumor suppressor. Promotes rapid degradation of CTNNB1 and participates in Wnt signaling as a negative regulator. APC activity is correlated with its phosphorylation state. Activates the GEF activity of SPATA13 and ARHGEF4. Plays a role in hepatocyte growth factor (HGF) -induced cell migration. Required for MMP9 up-regulation via the JNK signaling pathway in colorectal tumor cells. Acts as a mediator of ERBB2-dependent stabilization of microtubules at the cell cortex. It is required for the localization of MACF1 to the cell membrane and this localization of MACF1 is critical for its function in microtubule stabilization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.4 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d15 ORF Vector (Mouse) (pORF)
ORF059161 1.0 µg DNA

Tbc1d15 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]
APR33686G-01 50 µL

Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]
APR33686G-02 100 µL

Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]
APR33686G-03 200 µL

Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]
APR33686G-04 400 µL

Anti-SARS-CoV-2 Spike glycoprotein antibody (D1153) [APR33686G]

Sign In for Pricing
View Details
Chst13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6218608 1.0 µg DNA

Chst13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details