Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin B9, Human (HEK293, His)

The Serpin B9 Protein, a member of the serpin family, crucially regulates immune responses by specifically inhibiting granzyme B, a protease involved in immune cell-mediated apoptosis. Acting as a potent inhibitor, Serpin B9 modulates granzyme B's cytotoxic activity, fine-tuning immune responses and preventing unwarranted cell death, emphasizing its significance in maintaining immune balance. Serpin B9 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B9 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin B9 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-b9-protein-human-hek-293-his.html

Purity

95.00

Smiles

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

Molecular Formula

5272 (Gene_ID) P50453 (M1-P376) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF640R conjugate, 0.1mg/mL
BNC402383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details