Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Inner membrane protein p54 (p54), partial

Product Specifications

Abbreviation

Recombinant African swine fever virus Inner membrane protein p54, partial

Gene Name

P54

UniProt

B2MUM6

Expression Region

53-184aa

Organism

African swine fever virus (ASFV)

Target Sequence

SSRKKKAAAIEEEDIQFINPYQDQQWVEVTPQPGTSKPAGATTASVGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAPAHPAEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HSP90 Antibody (D7alpha) [DyLight 755]
NB110-96872IR 0.1 mL

Mouse Monoclonal HSP90 Antibody (D7alpha) [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human TRIM27 Protein, N-His
HB027012-01 50 µg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRIM27 Protein, N-His
HB027012-02 100 µg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRIM27 Protein, N-His
HB027012-03 1 mg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (AP) discontinued
042461-AP 200 µL

SULT1B1, CT (SULT1B1, ST1B2, SULT1B2, Sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B2, Thyroid hormone sulfotransferase) (AP) discontinued

Sign In for Pricing
View Details
Catenin-β, phosphorylated (Y489) discontinued
341165-01 100 µL

Catenin-β, phosphorylated (Y489) discontinued

Sign In for Pricing
View Details