Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-G-associated kinase (GAK), partial, Biotinylated

Product Specifications

Abbreviation

Recombinant Human GAK protein, partial, Biotinylated

Gene Name

GAK

UniProt

O14976

Expression Region

40-314aa

Organism

Homo sapiens (Human)

Target Sequence

LRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQ

Tag

N-terminal GST-tagged and C-terminal Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Associates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human N-ethylmaleimide-sensitive factor attachment protein, beta polyclonal Antibody
MBS713612-01 0.1 mL

Rabbit anti-human N-ethylmaleimide-sensitive factor attachment protein, beta polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human N-ethylmaleimide-sensitive factor attachment protein, beta polyclonal Antibody
MBS713612-02 5x 0.1 mL

Rabbit anti-human N-ethylmaleimide-sensitive factor attachment protein, beta polyclonal Antibody

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide Y (NPY)
SDPA480Hu21-01 10 µg

OVA Conjugated Neuropeptide Y (NPY)

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide Y (NPY)
SDPA480Hu21-02 50 µg

OVA Conjugated Neuropeptide Y (NPY)

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide Y (NPY)
SDPA480Hu21-03 200 µg

OVA Conjugated Neuropeptide Y (NPY)

Sign In for Pricing
View Details
OVA Conjugated Neuropeptide Y (NPY)
SDPA480Hu21-04 1 mg

OVA Conjugated Neuropeptide Y (NPY)

Sign In for Pricing
View Details