Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPA33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpa33-protein-mouse-hek293-his.html

Purity

96.0

Smiles

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Molecular Formula

59290 (Gene_ID) Q9JKA5/NP_067623.1 (L22-I235) (Accession)

Molecular Weight

Approximately 31-39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47513061 1.0 µg DNA

TRAPPC11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Zfp9 3'UTR Luciferase Stable Cell Line
TU122905 1.0 mL

Zfp9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Septin 14 rabbit pAb
ES5840-01 50 µL

Septin 14 rabbit pAb

Sign In for Pricing
View Details
Septin 14 rabbit pAb
ES5840-02 100 µL

Septin 14 rabbit pAb

Sign In for Pricing
View Details
Lacto phenol for microscopy
3123000 1 Each

Lacto phenol for microscopy

Sign In for Pricing
View Details
4- (4- (4- (4-Hydroxyphenyl) piperazin-1-yl) phenyl) -1- (prop-1-en-2-yl) -1H-1,2,4-triazol-5 (4H) -one
428966-01 5 mg

4- (4- (4- (4-Hydroxyphenyl) piperazin-1-yl) phenyl) -1- (prop-1-en-2-yl) -1H-1,2,4-triazol-5 (4H) -one

Sign In for Pricing
View Details