Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPA33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpa33-protein-mouse-hek293-his.html

Purity

96.0

Smiles

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Molecular Formula

59290 (Gene_ID) Q9JKA5/NP_067623.1 (L22-I235) (Accession)

Molecular Weight

Approximately 31-39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cog6 shRNA (UAS) - Lentiviral mouse Cog6 shRNA (UAS, GFP) (100)
GTR15175161 1 Vial

Lentiviral mouse Cog6 shRNA (UAS) - Lentiviral mouse Cog6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SLC12A9 Adenovirus (Mouse)
43878054 1.0 mL

SLC12A9 Adenovirus (Mouse)

Sign In for Pricing
View Details
Universal micro DNA cleanup and concentrate kit
BPC1130 100 Tests

Universal micro DNA cleanup and concentrate kit

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r67 shRNA (UAS) - Lentiviral mouse Vmn1r67 shRNA (UAS) (25)
GTR15146717 1 Vial

Lentiviral mouse Vmn1r67 shRNA (UAS) - Lentiviral mouse Vmn1r67 shRNA (UAS) (25)

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 650) discontinued
C2277-06Q-ML650 100 µL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 650) discontinued

Sign In for Pricing
View Details
FRAXD 3'UTR Luciferase Stable Cell Line
TU008270 1.0 mL

FRAXD 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details