Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPA33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpa33-protein-mouse-hek293-his.html

Purity

96.0

Smiles

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Molecular Formula

59290 (Gene_ID) Q9JKA5/NP_067623.1 (L22-I235) (Accession)

Molecular Weight

Approximately 31-39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Cytokeratin, Multi (Epithelial Marker) Antibody - With BSA and Azide, Clone: C11
APR14629G 0.05mg

Monoclonal Cytokeratin, Multi (Epithelial Marker) Antibody - With BSA and Azide, Clone: C11

Sign In for Pricing
View Details
Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit
MBS9328702-01 48 Well

Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit

Sign In for Pricing
View Details
Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit
MBS9328702-02 96 Well

Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit

Sign In for Pricing
View Details
Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit
MBS9328702-03 5x 96 Well

Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit

Sign In for Pricing
View Details
Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit
MBS9328702-04 10x 96 Well

Mouse Sodium-driven chloride bicarbonate exchanger, SLC4A10 ELISA Kit

Sign In for Pricing
View Details
Impa2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4783303 1.0 µg DNA

Impa2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details