Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPA33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpa33-protein-mouse-hek293-his.html

Purity

96.0

Smiles

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Molecular Formula

59290 (Gene_ID) Q9JKA5/NP_067623.1 (L22-I235) (Accession)

Molecular Weight

Approximately 31-39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kng1l1 Protein Vector (Rat) (pPM-C-His)
PV276669 500 ng

Kng1l1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RN7SL6P 3'UTR Lenti-reporter-Luc Vector
40189081 1.0 µg

RN7SL6P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ZNF415 sgRNA CRISPR Lentivector (Human) (Target 1)
K2704602 1.0 µg DNA

ZNF415 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
C17orf59 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9838R-BF488 100 µL

C17orf59 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Lentiviral human ZNF676 sgRNA gene knockout kit - Lentiviral human ZNF676 sgRNA gene knockout kit (100)
GTR15362650 1 Vial

Lentiviral human ZNF676 sgRNA gene knockout kit - Lentiviral human ZNF676 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human Cytochrome P450 26B1 (CYP26B1) ELISA Kit
RK10696 96 Tests

Human Cytochrome P450 26B1 (CYP26B1) ELISA Kit

Sign In for Pricing
View Details