Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPA33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpa33-protein-mouse-hek293-his.html

Purity

96.0

Smiles

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Molecular Formula

59290 (Gene_ID) Q9JKA5/NP_067623.1 (L22-I235) (Accession)

Molecular Weight

Approximately 31-39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFR-S274 (TNFRSF1A, TNFAR, TNFR1, Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, p55, p60, CD120a, Tumor necrosis factor receptor superfamily member 1A, membrane form, Tumor necrosis factor-binding protein 1) (MaxLight 750) discontinued
043068-ML750 100 µL

TNFR-S274 (TNFRSF1A, TNFAR, TNFR1, Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, p55, p60, CD120a, Tumor necrosis factor receptor superfamily member 1A, membrane form, Tumor necrosis factor-binding protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FEM 1B (FEM1B) (NM_015322) Human Over-expression Lysate
LH09608V 100 µg

FEM 1B (FEM1B) (NM_015322) Human Over-expression Lysate

Sign In for Pricing
View Details
Nup210 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4855402 1.0 µg DNA

Nup210 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Phospho-CREB (S133) MAb (Clone 702710)
MAB6906-SP 25 µg

Human Phospho-CREB (S133) MAb (Clone 702710)

Sign In for Pricing
View Details
Lentiviral human CACNB2 shRNA (UAS) - Lentiviral human CACNB2 shRNA (UAS, GFP) (25)
GTR15132152 1 Vial

Lentiviral human CACNB2 shRNA (UAS) - Lentiviral human CACNB2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Chicken Interleukin-36 beta ELISA Kit
MBS752883-01 48 Well

Chicken Interleukin-36 beta ELISA Kit

Sign In for Pricing
View Details