Troponin C/TNNC1, Human (His, solution)
Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Troponin C/TNNC1 Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tnnc1-protein-human-his.html
Purity
98.0
Smiles
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Molecular Formula
7134 (Gene_ID) P63316 (M1-E161) (Accession)
Molecular Weight
17-20 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2973049-01 50 Tests
OSM/Oncostatin-M Mouse Monoclonal Antibody (APC)
Sign In for Pricing
View Details orb2973049-02 100 Tests
OSM/Oncostatin-M Mouse Monoclonal Antibody (APC)
Sign In for Pricing
View Details 
bsm-52507R-PE-Cy7-01 20 µL
Phospho-Tau (Thr231) Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details bsm-52507R-PE-Cy7-02 100 µL
Phospho-Tau (Thr231) Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details