PCV2 cap (1-42) Peptide
This product is PCV2 cap (1-42) Peptide. Its protein sequence is MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKN (1-42/233) . Purification is performed using HPLC.
Product Specifications
Product Name Alternative
PCV2 ORF2; PCV-2; PCV 2; PCV2; Porcine circovirus 2; Porcine circovirus2; Porcine circovirus-2; Porcine circovirus 2 capsid protein; Porcine circovirus 2; CAPSD_PCV2.
Form
Lyophilized
Storage Conditions
Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Notes
For research use only.
AA Sequence
MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKN (1-42/233)
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7536107 1.0 µg DNA
Cacna1d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 
GTR15117393 1 Vial
Lentiviral human FSCB shRNA (UAS) - Lentiviral human FSCB shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details orb1361889 20 µg
HnRNP A2B1 (HNRNPA2B1) Human Over-expression Lysate
Sign In for Pricing
View Details MBS2043167-01 0.1 mL
FITC-Linked Polyclonal Antibody to Protein Kinase D2 (PKD2)
Sign In for Pricing
View Details MBS2043167-02 0.2 mL
FITC-Linked Polyclonal Antibody to Protein Kinase D2 (PKD2)
Sign In for Pricing
View Details