Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCV2 cap (1-42) Peptide

This product is PCV2 cap (1-42) Peptide. Its protein sequence is MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKN (1-42/233) . Purification is performed using HPLC.

Product Specifications

Product Name Alternative

PCV2 ORF2; PCV-2; PCV 2; PCV2; Porcine circovirus 2; Porcine circovirus2; Porcine circovirus-2; Porcine circovirus 2 capsid protein; Porcine circovirus 2; CAPSD_PCV2.

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKN (1-42/233)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP1 (C1QTNF1) (NM_153372) Human Tagged ORF Clone
RG233633 10 µg

CTRP1 (C1QTNF1) (NM_153372) Human Tagged ORF Clone

Sign In for Pricing
View Details
Conjugated SLC25A12 Rabbit mAb
C57343 100 µL

Conjugated SLC25A12 Rabbit mAb

Sign In for Pricing
View Details
Trypsin-3 / PRSS3 (81-304, His-tag) Human Protein
AR51079PU-S 100 µg

Trypsin-3 / PRSS3 (81-304, His-tag) Human Protein

Sign In for Pricing
View Details
SLTM Polyclonal Antibody, APC Conjugated
bs-7667R-APC-01 20 µL

SLTM Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SLTM Polyclonal Antibody, APC Conjugated
bs-7667R-APC-02 100 µL

SLTM Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
STK33 siRNA (m)
sc-153899 10 µM

STK33 siRNA (m)

Sign In for Pricing
View Details