Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CMRF35-like molecule 6 (Cd300c), partial

Product Specifications

Product Name Alternative

CLM-6; CD300 antigen-like family member C; CD antigen CD300c

Abbreviation

Recombinant Mouse Cd300c protein, partial

Gene Name

Cd300c

UniProt

A2A7V7

Expression Region

22-188aa

Organism

Mus musculus (Mouse)

Target Sequence

HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-10 Recombinant Rabbit Monoclonal Antibody [PSH02-22] - BSA and Azide free (Detector)
HA721787 100 µL

Rat IL-10 Recombinant Rabbit Monoclonal Antibody [PSH02-22] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Human DEFB134 activation kit by CRISPRa
GA118644 1 Kit

Human DEFB134 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633026 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human STMND1 activation kit by CRISPRa
GA118316 1 Kit

Human STMND1 activation kit by CRISPRa

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B5]
TA801993BM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B5]

Sign In for Pricing
View Details
TTPAL (NM_001039199) Human Recombinant Protein
TP316730M 100 µg

TTPAL (NM_001039199) Human Recombinant Protein

Sign In for Pricing
View Details