Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin Peptide

This product is Calcitonin Peptide. Its protein sequence is CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7) . Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Alpha CGRP; alpha type CGRP; CALC 1; CALC A; CALC1; CALC1; CALCA; calcitonin 1; calcitonin gene related peptide 1; calcitonin gene related peptide I; Calcitonin related polypeptide alpha; CGRP 1; CGRP; CGRP I; CGRP1; CGRP1; CGRPI; CT; CT; Katacalcin; KC; KC; CALC_HUMAN; MGC126648; calcitonin isoform CT preproprotein.

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD1 Rabbit Monoclonal Antibody [Clone ID: 23GB2800]
TA425274 100 µL

TEAD1 Rabbit Monoclonal Antibody [Clone ID: 23GB2800]

Sign In for Pricing
View Details
Dynactin 2 Polyclonal Antibody
E040856 100 µg -100 µL

Dynactin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Grlf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4240708 1.0 µg DNA

Grlf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human LMOD3 knockdown cell line
ABC-KD8529 1 Vial

Human LMOD3 knockdown cell line

Sign In for Pricing
View Details
GBA2 Rabbit Polyclonal Antibody (BF680)
orb2525951 100 µL

GBA2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
TAFA2 Human shRNA Lentiviral Particle (Locus ID 338811)
TL318345V 500 µL Each

TAFA2 Human shRNA Lentiviral Particle (Locus ID 338811)

Sign In for Pricing
View Details