Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin Peptide

This product is Calcitonin Peptide. Its protein sequence is CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7) . Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Alpha CGRP; alpha type CGRP; CALC 1; CALC A; CALC1; CALC1; CALCA; calcitonin 1; calcitonin gene related peptide 1; calcitonin gene related peptide I; Calcitonin related polypeptide alpha; CGRP 1; CGRP; CGRP I; CGRP1; CGRP1; CGRPI; CT; CT; Katacalcin; KC; KC; CALC_HUMAN; MGC126648; calcitonin isoform CT preproprotein.

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Total Carbonyl Colorimetric Assay Kit
MBS2563698-01 48 Tests

Total Carbonyl Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Carbonyl Colorimetric Assay Kit
MBS2563698-02 96 Tests

Total Carbonyl Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Carbonyl Colorimetric Assay Kit
MBS2563698-03 500 Assays

Total Carbonyl Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Carbonyl Colorimetric Assay Kit
MBS2563698-04 5x 500 Assays

Total Carbonyl Colorimetric Assay Kit

Sign In for Pricing
View Details
ABHD5 Rabbit Polyclonal Antibody (BF555)
orb2414233 100 µL

ABHD5 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum nusB Protein (aa 1-145)
VAng-Lsx02008-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Thermocellum nusB Protein (aa 1-145)

Sign In for Pricing
View Details