Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin Peptide

This product is Calcitonin Peptide. Its protein sequence is CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7) . Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Alpha CGRP; alpha type CGRP; CALC 1; CALC A; CALC1; CALC1; CALCA; calcitonin 1; calcitonin gene related peptide 1; calcitonin gene related peptide I; Calcitonin related polypeptide alpha; CGRP 1; CGRP; CGRP I; CGRP1; CGRP1; CGRPI; CT; CT; Katacalcin; KC; KC; CALC_HUMAN; MGC126648; calcitonin isoform CT preproprotein.

Form

Lyophilized

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP 85-117/141, (Disulfide bond 1-7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Zebrafish cTnI (Cardiac Troponin I) ELISA Kit
GR206080 96 Well

Nori® Zebrafish cTnI (Cardiac Troponin I) ELISA Kit

Sign In for Pricing
View Details
UGT1A6B HDR Plasmid (m)
sc-436498-HDR 20 µg

UGT1A6B HDR Plasmid (m)

Sign In for Pricing
View Details
FK 3311 50mg
A13332-50 50 mg

FK 3311 50mg

Sign In for Pricing
View Details
Complete Medium for KHM-5M Cells
abx703718 500 mL

Complete Medium for KHM-5M Cells

Sign In for Pricing
View Details
RPS21P2 sgRNA CRISPR Lentivector (Human) (Target 2)
K2043703 1.0 µg DNA

RPS21P2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DDX4 Antibody
OAAI00479-100UG 100 µg

DDX4 Antibody

Sign In for Pricing
View Details