Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRF (Corticoliberin) Peptide

This product is CRF (Corticoliberin) Peptide. Its molecular weight is 5 kDa. Its protein sequence is SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK. It targets Corticoliberin. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Corticoliberin; Corticoliberin precursor; Corticotropin releasing factor; Corticotropin releasing hormone; Corticotropin releasing hormone deficiency included; crf; crh; crh deficiency included; corticoliberin preproprotein; CRF_HUMAN; Corticotropin-releasing factor; CRH1; CRH; Corticotropin-releasing hormone.

Field of Research

Hormone Research, Neuroscience

Form

Lyophilized

Molecular Weight

5 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRN4 Rabbit Polyclonal Antibody (Cy5)
orb878695 100 µL

BRN4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
CXCL11 Rabbit pAb, PE-Cy5.5 conjugated
orb2890436 100 µL

CXCL11 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
SYNPR/Synaptoporin Rabbit Polyclonal Antibody (BF488)
orb1601098 100 µL

SYNPR/Synaptoporin Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
TAS1R2 (NM_152232) Human Over-expression Lysate
LS080834-100ug 100 µg

TAS1R2 (NM_152232) Human Over-expression Lysate

Sign In for Pricing
View Details
Mmu-miR-151-3p miRNA Antagomir
orb1913682-01 10 nmol

Mmu-miR-151-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-151-3p miRNA Antagomir
orb1913682-02 20 nmol

Mmu-miR-151-3p miRNA Antagomir

Sign In for Pricing
View Details