Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRF (Corticoliberin) Peptide

This product is CRF (Corticoliberin) Peptide. Its molecular weight is 5 kDa. Its protein sequence is SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK. It targets Corticoliberin. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Corticoliberin; Corticoliberin precursor; Corticotropin releasing factor; Corticotropin releasing hormone; Corticotropin releasing hormone deficiency included; crf; crh; crh deficiency included; corticoliberin preproprotein; CRF_HUMAN; Corticotropin-releasing factor; CRH1; CRH; Corticotropin-releasing hormone.

Field of Research

Hormone Research, Neuroscience

Form

Lyophilized

Molecular Weight

5 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP7 siRNA (Human)
orb1852897-01 15 nmol

MPP7 siRNA (Human)

Sign In for Pricing
View Details
MPP7 siRNA (Human)
orb1852897-02 30 nmol

MPP7 siRNA (Human)

Sign In for Pricing
View Details
SYNGR2P2 ORF Vector (Human) (pORF)
ORF033598 1.0 µg DNA

SYNGR2P2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
At2g02240 Antibody
orb788796 2 mg

At2g02240 Antibody

Sign In for Pricing
View Details
PCSK5 Antibody
F47688-0.08ML 0.08 mL

PCSK5 Antibody

Sign In for Pricing
View Details
KRT15 (Keratin, Type I Cytoskeletal 15, Cytokeratin-15, CK-15, Keratin-15, K15, KRTB) (MaxLight 550)
MBS6383846-01 0.1 mL

KRT15 (Keratin, Type I Cytoskeletal 15, Cytokeratin-15, CK-15, Keratin-15, K15, KRTB) (MaxLight 550)

Sign In for Pricing
View Details