Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417T) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

S

UniProt

P0DTC2

Expression Region

319-541aa(K417T)

Organism

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Target Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Cancer

Assay Type

Developed Protein & Coronavirus Protein

Relevance

attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein . Uses also human TMPRSS2 for priming in human lung cells which is an essential step for viral entry . Can be alternatively processed by host furin . Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.8 kDa

References & Citations

"SARS-CoV-2 cell entry depends on ACE2 and TMPRSS2 and is blocked by a clinically proven protease inhibitor." Hoffmann M., Kleine-Weber H., Schroeder S., Krueger N., Herrler T., Erichsen S., Schiergens T.S., Herrler G., Wu N.H., Nitsche A., Mueller M.A., Drosten C., Poehlmann S. Cell 181:1-10 (2020)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human YBX3 siRNA
abx906120-01 15 nmol

Human YBX3 siRNA

Sign In for Pricing
View Details
Human YBX3 siRNA
abx906120-02 30 nmol

Human YBX3 siRNA

Sign In for Pricing
View Details
SGK1 / SGK (60-431, His-tag) Human Protein
AR50057PU-N 250 µg

SGK1 / SGK (60-431, His-tag) Human Protein

Sign In for Pricing
View Details
Rabbit Monoclonal Fc gamma RI/CD64 Antibody (005) [PE]
NBP2-90842PE 0.1 mL

Rabbit Monoclonal Fc gamma RI/CD64 Antibody (005) [PE]

Sign In for Pricing
View Details
Ctnna1 (NM_001007145) Rat Tagged Lenti ORF Clone
RR203630L4 10 µg

Ctnna1 (NM_001007145) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PHF21A (NM_001101802) Human Tagged ORF Clone Lentiviral Particle
RC213929L1V 200 µL

PHF21A (NM_001101802) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details