Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Canine

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-canine.html

Purity

97.00

Smiles

KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA

Molecular Formula

403507 (Gene_ID) Q06220 (K26-A190) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A6 (NM_001636) Human Over-expression Lysate
LY419829 100 µg

SLC25A6 (NM_001636) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB502642 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Alpha-Cyano-Alpha,Beta-diethylvaleric Acid Ethyl Ester
TRC-C956050-1G 1 g

Alpha-Cyano-Alpha,Beta-diethylvaleric Acid Ethyl Ester

Sign In for Pricing
View Details
Human PSMA8 activation kit by CRISPRa
GA115459 1 Kit

Human PSMA8 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Artery: carotid
CB532431 1 Block

Frozen Tissue Blocks, Artery: carotid

Sign In for Pricing
View Details
Thiobenzoic Acid (94%)(Benzenecarbothioic Acid)
TRC-B189000-50G 50 g

Thiobenzoic Acid (94%)(Benzenecarbothioic Acid)

Sign In for Pricing
View Details