Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Canine

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-canine.html

Purity

97.00

Smiles

KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA

Molecular Formula

403507 (Gene_ID) Q06220 (K26-A190) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Capn3 activation kit by CRISPRa
GA200514 1 Kit

Mouse Capn3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human TXNRD1/TRXR1 Protein (aa 161-647, His Tag)
PKSH030732 100 µg

Recombinant Human TXNRD1/TRXR1 Protein (aa 161-647, His Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus B7-2/CD86 Protein (Fc Tag)
PKSQ050017-01 10 µg

Recombinant Cynomolgus B7-2/CD86 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus B7-2/CD86 Protein (Fc Tag)
PKSQ050017-02 50 µg

Recombinant Cynomolgus B7-2/CD86 Protein (Fc Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS805578 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
1-Anilino-3-phenylimino-1-propene Hydrochloride
TRC-A458920-5G 5 g

1-Anilino-3-phenylimino-1-propene Hydrochloride

Sign In for Pricing
View Details