Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Canine

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-canine.html

Purity

97.00

Smiles

KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA

Molecular Formula

403507 (Gene_ID) Q06220 (K26-A190) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKC Rabbit Polyclonal Antibody
TA384504 100 µL

IGKC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560360 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
LOXL2 (NM_002318) Human Over-expression Lysate
LC400844 20 µg

LOXL2 (NM_002318) Human Over-expression Lysate

Sign In for Pricing
View Details
NQO2 Rabbit Polyclonal Antibody
AP18140PU-N 400 µL

NQO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,
AAF-531-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
FBXO8 Rabbit Polyclonal Antibody
TA370837 100 µL

FBXO8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details