Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Canine

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-canine.html

Purity

97.00

Smiles

KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA

Molecular Formula

403507 (Gene_ID) Q06220 (K26-A190) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA IX Monoclonal Antibody (12F10)
BT-MCA0013-01 20 µL

CA IX Monoclonal Antibody (12F10)

Sign In for Pricing
View Details
CA IX Monoclonal Antibody (12F10)
BT-MCA0013-02 50 µL

CA IX Monoclonal Antibody (12F10)

Sign In for Pricing
View Details
CA IX Monoclonal Antibody (12F10)
BT-MCA0013-03 100 µL

CA IX Monoclonal Antibody (12F10)

Sign In for Pricing
View Details
Fam227b (NM_029455) Mouse Tagged ORF Clone Lentiviral Particle
MR212721L4V 200 µL

Fam227b (NM_029455) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCDC160 (NM_001101357) Human Over-expression Lysate
LH02646V 100 µg

CCDC160 (NM_001101357) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH Recombinant Rabbit mAb, IRDye 800CW conjugated
orb3164644 100 µL

ACTH Recombinant Rabbit mAb, IRDye 800CW conjugated

Sign In for Pricing
View Details