Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peptide YY (Pyy), partial

Product Specifications

Product Name Alternative

(PYY) (Peptide tyrosine tyrosine) (3-36) (PYY-II)

Abbreviation

Recombinant Mouse Pyy protein, partial

Gene Name

Pyy

UniProt

Q9EPS2

Expression Region

29-64aa

Organism

Mus musculus (Mouse)

Target Sequence

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

References & Citations

"Expression of neurogenin3 reveals an islet cell precursor population in the pancreas." Schwitzgebel V.M., Scheel D.W., Conners J.R., Kalamaras J., Lee J.E., Anderson D.J., Sussel L., Johnson J.D., German M.S. Development 127:3533-3542 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Alpha synuclein (Ser129) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-5628R-BF680-01 20 µL

Phospho-Alpha synuclein (Ser129) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Phospho-Alpha synuclein (Ser129) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-5628R-BF680-02 100 µL

Phospho-Alpha synuclein (Ser129) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
orb1096351-01 20 µg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
orb1096351-02 100 µg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
orb1096351-03 1 mg

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Sign In for Pricing
View Details
CIAO3 (NM_022493) Human Over-expression Lysate
LH11731V 100 µg

CIAO3 (NM_022493) Human Over-expression Lysate

Sign In for Pricing
View Details