Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peptide YY (Pyy), partial

Product Specifications

Product Name Alternative

(PYY) (Peptide tyrosine tyrosine) (3-36) (PYY-II)

Abbreviation

Recombinant Mouse Pyy protein, partial

Gene Name

Pyy

UniProt

Q9EPS2

Expression Region

29-64aa

Organism

Mus musculus (Mouse)

Target Sequence

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

References & Citations

"Expression of neurogenin3 reveals an islet cell precursor population in the pancreas." Schwitzgebel V.M., Scheel D.W., Conners J.R., Kalamaras J., Lee J.E., Anderson D.J., Sussel L., Johnson J.D., German M.S. Development 127:3533-3542 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat DDX39B shRNA Plasmid
abx987219-01 150 µg

Rat DDX39B shRNA Plasmid

Sign In for Pricing
View Details
Rat DDX39B shRNA Plasmid
abx987219-02 300 µg

Rat DDX39B shRNA Plasmid

Sign In for Pricing
View Details
SMG6 polyclonal antibody
BS74386-01 50 µL

SMG6 polyclonal antibody

Sign In for Pricing
View Details
SMG6 polyclonal antibody
BS74386-02 100 µL

SMG6 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila UPF0145 AHA_2580 Protein
VAng-Lsx0769-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Hydrophila UPF0145 AHA_2580 Protein

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum comB Protein (aa 1-239) (strain 657 / Type Ba4)
VAng-Lsx8142-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum comB Protein (aa 1-239) (strain 657 / Type Ba4)

Sign In for Pricing
View Details