Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peptide YY (Pyy), partial

Product Specifications

Product Name Alternative

(PYY) (Peptide tyrosine tyrosine) (3-36) (PYY-II)

Abbreviation

Recombinant Mouse Pyy protein, partial

Gene Name

Pyy

UniProt

Q9EPS2

Expression Region

29-64aa

Organism

Mus musculus (Mouse)

Target Sequence

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

References & Citations

"Expression of neurogenin3 reveals an islet cell precursor population in the pancreas." Schwitzgebel V.M., Scheel D.W., Conners J.R., Kalamaras J., Lee J.E., Anderson D.J., Sussel L., Johnson J.D., German M.S. Development 127:3533-3542 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transient Receptor Potential Cation Channel Subfamily C Member 5 (TrpC5) Antibody (Streptavidin)
abx444640 100 µg

Transient Receptor Potential Cation Channel Subfamily C Member 5 (TrpC5) Antibody (Streptavidin)

Sign In for Pricing
View Details
IL13RA2 Rabbit Polyclonal Antibody (AP)
orb1599670 100 µL

IL13RA2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
PBK Rabbit Monoclonal Antibody
E56G3347 100 µL

PBK Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
EIF2S1 (Ser51) Recombinant Rabbit mAb, BF647 conjugated
orb2353156 100 µL

EIF2S1 (Ser51) Recombinant Rabbit mAb, BF647 conjugated

Sign In for Pricing
View Details
Folate Receptor Alpha/FOLR1 (BN3.2) Mouse Monoclonal Antibody
CST 37283S 100 µL

Folate Receptor Alpha/FOLR1 (BN3.2) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
KIAA0040 Human Over-expression Lysate
orb1340005 100 µg

KIAA0040 Human Over-expression Lysate

Sign In for Pricing
View Details