Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F12 Antibody Blocking Peptide

This product is F12 Antibody Blocking Peptide. It targets Coagulation factor XII. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Factor XII; Coagulation factor XII; Factor XII heavy chain; Coagulation factor XIIa heavy chain; F12; F12 deficiency; FA12_HUMAN; Factor XII deficiency; HAE3; HAEX; HAF; HAF deficiency; Hageman factor; Coagulation factor XIIa heavy chain.

Field of Research

Cardiovascular Research

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46982151 3x 1.0 µg DNA

TMEM2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 6, P54, RCK, HLR2) (APC)
MBS6413902-01 0.1 mL

DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 6, P54, RCK, HLR2) (APC)

Sign In for Pricing
View Details
DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 6, P54, RCK, HLR2) (APC)
MBS6413902-02 5x 0.1 mL

DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 6, P54, RCK, HLR2) (APC)

Sign In for Pricing
View Details
KIF3A Antibody
ASA-B1121 1 Each

KIF3A Antibody

Sign In for Pricing
View Details
HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)
H6000-05Z 1 mg

HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)

Sign In for Pricing
View Details
Olfr933 Protein Vector (Mouse) (pPM-C-HA)
33558024 500 ng

Olfr933 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details