Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSTN Antibody Blocking Peptide

This product is OSTN Antibody Blocking Peptide. Its molecular weight is 5.621 kDa. Its protein sequence is SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2. It targets Osteocrin. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Musclin; OSTN; OSTN_HUMAN.

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized

Molecular Weight

5.621 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCEL, ID (SCEL, Sciellin) (FITC) discontinued
041454-FITC 200 µL

SCEL, ID (SCEL, Sciellin) (FITC) discontinued

Sign In for Pricing
View Details
MonoMethyl-Histone H3 (K9) Antibody, mAb, Rabbit
A05036-100 100 µL

MonoMethyl-Histone H3 (K9) Antibody, mAb, Rabbit

Sign In for Pricing
View Details
PNPLA3 Recombinant Protein (Human)
RP023974 100 µg

PNPLA3 Recombinant Protein (Human)

Sign In for Pricing
View Details
BI 224436 10mg
A16018-10 10 mg

BI 224436 10mg

Sign In for Pricing
View Details
ERVFC1-1 Human shRNA Plasmid Kit (Locus ID 346547)
TL318384 1 Kit

ERVFC1-1 Human shRNA Plasmid Kit (Locus ID 346547)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum TPR repeat-containing protein DDB_G0287999 (DDB_G0287999), partial
MBS1462973 Inquire

Recombinant Dictyostelium discoideum TPR repeat-containing protein DDB_G0287999 (DDB_G0287999), partial

Sign In for Pricing
View Details