Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSTN Antibody Blocking Peptide

This product is OSTN Antibody Blocking Peptide. Its molecular weight is 5.621 kDa. Its protein sequence is SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2. It targets Osteocrin. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Musclin; OSTN; OSTN_HUMAN.

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized

Molecular Weight

5.621 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD2 siRNA (Mouse)
CRM2528-01 15 nmol

FOXD2 siRNA (Mouse)

Sign In for Pricing
View Details
FOXD2 siRNA (Mouse)
CRM2528-02 30 nmol

FOXD2 siRNA (Mouse)

Sign In for Pricing
View Details
CD3 (CD3 antigen, delta Subunit, CD3-DELTA, CD3D, CD3d antigen, delta Polypeptide (TiT3 Complex), CD3d Molecule, delta (CD3-TCR Complex), OKT3, delta chain, T-cell Receptor T3 delta chain, T-cell surface Glycoprotein CD3 delta chain, T3D)
253973 100 µL

CD3 (CD3 antigen, delta Subunit, CD3-DELTA, CD3D, CD3d antigen, delta Polypeptide (TiT3 Complex), CD3d Molecule, delta (CD3-TCR Complex), OKT3, delta chain, T-cell Receptor T3 delta chain, T-cell surface Glycoprotein CD3 delta chain, T3D)

Sign In for Pricing
View Details
Prkce (Pkce, Pkcea, Protein kinase C epsilon type, nPKC-epsilon) discontinued
136345 50 µL

Prkce (Pkce, Pkcea, Protein kinase C epsilon type, nPKC-epsilon) discontinued

Sign In for Pricing
View Details
STFR W023-450x150-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
829739 1 Card (1 Panel (s) x 1 Pack)

STFR W023-450x150-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Agfg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6628205 3x 1.0 µg

Agfg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details