Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSTN Antibody Blocking Peptide

This product is OSTN Antibody Blocking Peptide. Its molecular weight is 5.621 kDa. Its protein sequence is SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2. It targets Osteocrin. Purification is performed using HPLC.

Product Specifications

Product Name Alternative

Musclin; OSTN; OSTN_HUMAN.

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized

Molecular Weight

5.621 kDa

Storage Conditions

Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.

Notes

For research use only.

AA Sequence

SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185F-01 50 Tests

PerCP Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185F-02 100 Tests

PerCP Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185F-03 2x 100 Tests

PerCP Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Rat Dentin Sialophosphoprotein (DSPP) ELISA Kit
abx519601 96 Tests

Rat Dentin Sialophosphoprotein (DSPP) ELISA Kit

Sign In for Pricing
View Details
ZDHHC16 Antibody
MBS7043635-01 0.05 mL

ZDHHC16 Antibody

Sign In for Pricing
View Details
ZDHHC16 Antibody
MBS7043635-02 0.1 mL

ZDHHC16 Antibody

Sign In for Pricing
View Details