Question 1

What is the catalog number for Thymosin beta 4 Peptide?

Accepted Answer

The catalog number for Thymosin beta 4 Peptide is orb1500050.

Question 2

What sizes are available for Thymosin beta 4 Peptide?

Accepted Answer

Thymosin beta 4 Peptide is available in the following size(s): 500 µg.

Question 3

Is Thymosin beta 4 Peptide in stock?

Accepted Answer

Thymosin beta 4 Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What is Thymosin beta 4 Peptide used for?

Accepted Answer

This product is Thymosin beta 4 Peptide. Its protein sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (2-44/44) . Purification is performed using HPLC. Thymosin beta 4 Peptide is supplied for research use only and is intended for laboratory research involving animal models. Biorbyt supplies t

Question 5

Is this product covered by a money-back guarantee?

Accepted Answer

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Question 6

Can this product be used for diagnostic or therapeutic purposes?

Accepted Answer

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

Question 7

What is the shelf life of this product?

Accepted Answer

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

Thymosin beta 4 Peptide

Product Specifications

Form

Storage Conditions

Notes

AA Sequence

Frequently Asked Questions

Explore Other Products

Anti-Abi-2 Antibody

Anti-Abi-2 Antibody

Anti-Abi-2 Antibody

Anti-Abi-2 Antibody

Anti-Abi-2 Antibody

PSAP (Cerebroside Sulfate Activator, FLJ00245, GLBA, MGC110993, Prosaposin, SAP1) (AP)