Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lunasin peptide

This product is lunasin peptide. Its protein sequence is SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD. It achieves a purity of > 95% as determined by HPLC. Purification is performed using HPLC.

Product Specifications

Purity

> 95% as determined by HPLC

Form

Lyophilized

Storage Conditions

Store at -20°C.

Notes

For research use only.

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfactory receptor 4A15 (OR4A15) ELISA kit
GTR10370320 96 Well

Mouse Olfactory receptor 4A15 (OR4A15) ELISA kit

Sign In for Pricing
View Details
TGF alpha (Transforming Growth Factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued
370255-01 48 Tests

TGF alpha (Transforming Growth Factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
TGF alpha (Transforming Growth Factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued
370255-02 96 Tests

TGF alpha (Transforming Growth Factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
Serine/Threonine Kinase 38 Like (STK38L) Antibody
abx145699-01 100 µg

Serine/Threonine Kinase 38 Like (STK38L) Antibody

Sign In for Pricing
View Details
Serine/Threonine Kinase 38 Like (STK38L) Antibody
abx145699-02 1 mg

Serine/Threonine Kinase 38 Like (STK38L) Antibody

Sign In for Pricing
View Details
Human FAM3D/Protein FAM3D ELISA Kit
MBS2904403-01 48 Well

Human FAM3D/Protein FAM3D ELISA Kit

Sign In for Pricing
View Details