Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lunasin peptide

This product is lunasin peptide. Its protein sequence is SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD. It achieves a purity of > 95% as determined by HPLC. Purification is performed using HPLC.

Product Specifications

Purity

> 95% as determined by HPLC

Form

Lyophilized

Storage Conditions

Store at -20°C.

Notes

For research use only.

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFYVE16 knockout cell line
ABC-KH17308 1 Vial

Human ZFYVE16 knockout cell line

Sign In for Pricing
View Details
COX2 Rabbit Polyclonal Antibody
TA378731 100 µL

COX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NMUR1 Recombinant Protein (Mouse)
RP154451 100 µg

NMUR1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-ARL6IP4 Antibody
MBS8306051-01 0.03 mL

Anti-ARL6IP4 Antibody

Sign In for Pricing
View Details
Anti-ARL6IP4 Antibody
MBS8306051-02 0.05 mL

Anti-ARL6IP4 Antibody

Sign In for Pricing
View Details
Anti-ARL6IP4 Antibody
MBS8306051-03 0.1 mL

Anti-ARL6IP4 Antibody

Sign In for Pricing
View Details