Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lunasin peptide

This product is lunasin peptide. Its protein sequence is SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD. It achieves a purity of > 95% as determined by HPLC. Purification is performed using HPLC.

Product Specifications

Purity

> 95% as determined by HPLC

Form

Lyophilized

Storage Conditions

Store at -20°C.

Notes

For research use only.

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-EPAC1 Antibody
DL91478A-01 50 µL

Rabbit anti-EPAC1 Antibody

Sign In for Pricing
View Details
Rabbit anti-EPAC1 Antibody
DL91478A-02 100 µL

Rabbit anti-EPAC1 Antibody

Sign In for Pricing
View Details
TEX10 (NM_017746) Human 3' UTR Clone
SC200983 10 µg

TEX10 (NM_017746) Human 3' UTR Clone

Sign In for Pricing
View Details
Human SLC12A2 Knockout HEK293T cell line
GTR15416593 1 Vial

Human SLC12A2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-GAMT Polyclonal Antibody
HC532014-01 50 µg

Anti-GAMT Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAMT Polyclonal Antibody
HC532014-02 100 µg

Anti-GAMT Polyclonal Antibody

Sign In for Pricing
View Details