Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prb1 (BC011176) Mouse Tagged Lenti ORF Clone
MR208106L4 10 µg

Prb1 (BC011176) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant PDHA1 (phospho S293) Antibody
RC-16746-01 50 μL

Recombinant PDHA1 (phospho S293) Antibody

Sign In for Pricing
View Details
Recombinant PDHA1 (phospho S293) Antibody
RC-16746-02 100 µL

Recombinant PDHA1 (phospho S293) Antibody

Sign In for Pricing
View Details
Recombinant PDHA1 (phospho S293) Antibody
RC-16746-03 1 mL

Recombinant PDHA1 (phospho S293) Antibody

Sign In for Pricing
View Details
CD161 (NKR, NKR-PI, NKR-P1A, CLEC5B, Killer Cell Lectin like Receptor Subfamily B Member 1, KLRB1) (HRP) discontinued
C2548-88F1-HRP 100 µL

CD161 (NKR, NKR-PI, NKR-P1A, CLEC5B, Killer Cell Lectin like Receptor Subfamily B Member 1, KLRB1) (HRP) discontinued

Sign In for Pricing
View Details
Rb Polyclonal Antibody
ABP52332-01 30 µL

Rb Polyclonal Antibody

Sign In for Pricing
View Details