Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Sheep PAPP-A ELISA Kit
GR116395 96 Well

Nori® Sheep PAPP-A ELISA Kit

Sign In for Pricing
View Details
Urease-IN-22
HY-175644 1 Each

Urease-IN-22

Sign In for Pricing
View Details
SERC1 Mouse Monoclonal Antibody
BF8654-01 100 µL

SERC1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SERC1 Mouse Monoclonal Antibody
BF8654-02 200 µL

SERC1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) (100)
GTR15190116 1 Vial

Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MLC1SA (MYL6B) Rabbit Polyclonal Antibody
TA357002 100 µL

MLC1SA (MYL6B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details