Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-1273e-Off Virus
mh5118 1.0 mL

AdmiRa-hsa-miR-1273e-Off Virus

Sign In for Pricing
View Details
Hepatitis C Virus (HCV) Core Antigen (MaxLight 405)
MBS6188228-01 0.1 mL

Hepatitis C Virus (HCV) Core Antigen (MaxLight 405)

Sign In for Pricing
View Details
Hepatitis C Virus (HCV) Core Antigen (MaxLight 405)
MBS6188228-02 5x 0.1 mL

Hepatitis C Virus (HCV) Core Antigen (MaxLight 405)

Sign In for Pricing
View Details
Per3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3930605 3x 1.0 µg

Per3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Ankrd28 Mouse qPCR Primer Pair (NM_001024604)
MP200740 200 Reactions

Ankrd28 Mouse qPCR Primer Pair (NM_001024604)

Sign In for Pricing
View Details
Rotavirus A (strain St. Thomas 3) VP6 Protein (His)
MF-0130084-01 5 µg

Rotavirus A (strain St. Thomas 3) VP6 Protein (His)

Sign In for Pricing
View Details