Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTY (NM_182659) Human 3' UTR Clone
SC202307 10 µg

UTY (NM_182659) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse Monoclonal BST2 Antibody (4F6) [mFluor Violet 450 SE]
NBP2-29622MFV450 0.1 mL

Mouse Monoclonal BST2 Antibody (4F6) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal KCNK1 Antibody [DyLight 488]
NBP2-41301G 0.1 mL

Rabbit Polyclonal KCNK1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) Rabbit Polyclonal Antibody
TA375941 100 µL

Eph receptor B6 (EPHB6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PGM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV704886 1.0 µg DNA

PGM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Anti-Canine Ryanodine Receptor Monoclonal Antibody
VD11N164 1 Each

Mouse Anti-Canine Ryanodine Receptor Monoclonal Antibody

Sign In for Pricing
View Details