Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque GMPPB Protein, His (Fc)-Avi-tagged
GMPPB-1707R 50 µg

Recombinant Rhesus Macaque GMPPB Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
LYPD4 siRNA (Mouse)
CRN3036-01 15 nmol

LYPD4 siRNA (Mouse)

Sign In for Pricing
View Details
LYPD4 siRNA (Mouse)
CRN3036-02 30 nmol

LYPD4 siRNA (Mouse)

Sign In for Pricing
View Details
Phospho-ZAP-70 (Tyr493) Cell-Based ELISA Kit
CBP1709 1 Kit

Phospho-ZAP-70 (Tyr493) Cell-Based ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PDP1 Polyclonal Antibody
MBS7181694 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PDP1 Polyclonal Antibody

Sign In for Pricing
View Details
NPM1 antibody
70R-18940 50 ul

NPM1 antibody

Sign In for Pricing
View Details