EFNB2A, zebrafish (HEK293, His)
The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html
Purity
95.00
Smiles
LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA
Molecular Formula
30219 (Gene_ID) O73874 (L25-A222) (Accession)
Molecular Weight
Approximately 30-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9012744 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP707A4 Polyclonal Antibody
Sign In for Pricing
View Details 
RC202611L4V 200 µL
ANKH (NM_054027) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 127890-PE 100 µL
HLA Class 1 Antigen B (HLA Cass I Histocompatibility Antigen B-27 alpha Chain, HLA B Class I, HLA-B, HLAB, HLA-B27, HLA-B73, AS, MGC111087, MHC Class I Antigen B*27, SPDA1) (PE)
Sign In for Pricing
View Details