Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILVBL Mouse Monoclonal Antibody [Clone ID: OTI8A12]
CF503078 100 µg

ILVBL Mouse Monoclonal Antibody [Clone ID: OTI8A12]

Sign In for Pricing
View Details
NPY5-R discontinued
392344 200 µL

NPY5-R discontinued

Sign In for Pricing
View Details
IL1RAP (NM_134470) Human Recombinant Protein
TP308786L 1 mg

IL1RAP (NM_134470) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human DDR2 Kinase/CD167b Protein (Fc Tag)
PKSH031758 100 µg

Recombinant Human DDR2 Kinase/CD167b Protein (Fc Tag)

Sign In for Pricing
View Details
Cytokeratin 7 Rabbit Monoclonal Antibody
AMRe01890-01 1 Each

Cytokeratin 7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 Rabbit Monoclonal Antibody
AMRe01890-02 50 µL

Cytokeratin 7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details