Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPA Antibody
A60242-50UL 50 μL

ASPA Antibody

Sign In for Pricing
View Details
PTPRCAP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38171154 3x 1.0 µg DNA

PTPRCAP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (C66/195) [Alexa Fluor 700]
NBP2-47973AF700 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (C66/195) [Alexa Fluor 700]

Sign In for Pricing
View Details
Duck Keratin, Type I Cytoskeletal 24 (KRT24) ELISA Kit
MBS9939657 Inquire

Duck Keratin, Type I Cytoskeletal 24 (KRT24) ELISA Kit

Sign In for Pricing
View Details
Aminoacylase 1 (ACY1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI2B5]
TA700052 50 µg

Aminoacylase 1 (ACY1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details
GFP hsa-let-7b-5p AAV miRNA Vector
Amh1000400 500 ng

GFP hsa-let-7b-5p AAV miRNA Vector

Sign In for Pricing
View Details