Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxytroflavoside G
HY-N12268 1 Each

Oxytroflavoside G

Sign In for Pricing
View Details
Rabbit Polyclonal PROSER1 Antibody [Biotin]
NBP3-05784B 0.1 mL

Rabbit Polyclonal PROSER1 Antibody [Biotin]

Sign In for Pricing
View Details
FBXO8 (F-box Only Protein 8, F-box/SEC7 Protein FBS, FBS, FBX8, DC10, UNQ1877/PRO4320) (MaxLight 490)
126709-ML490 100 µL

FBXO8 (F-box Only Protein 8, F-box/SEC7 Protein FBS, FBS, FBX8, DC10, UNQ1877/PRO4320) (MaxLight 490)

Sign In for Pricing
View Details
Prom1 (NM_001163581) Mouse Tagged ORF Clone
MG225619 10 µg

Prom1 (NM_001163581) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sheep Anti Mouse Factor II (Prothrombin) Polyclonal Affinity Purified Biotin Labeled 100ug
ISHAMSFIIAPBL100UG 100 µg

Sheep Anti Mouse Factor II (Prothrombin) Polyclonal Affinity Purified Biotin Labeled 100ug

Sign In for Pricing
View Details
Mouse Plaur qPCR Primer Pair
QM04554S 200 Tests

Mouse Plaur qPCR Primer Pair

Sign In for Pricing
View Details