EFNB2A, zebrafish (HEK293, His)
The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html
Purity
95.00
Smiles
LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA
Molecular Formula
30219 (Gene_ID) O73874 (L25-A222) (Accession)
Molecular Weight
Approximately 30-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2362208 1.0 µg DNA
TFDP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details ![CIAPIN1 Mouse Monoclonal Antibody [Clone ID: LBI5A6]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
AMM18603VCF 100 µg
CIAPIN1 Mouse Monoclonal Antibody [Clone ID: LBI5A6]
Sign In for Pricing
View Details 
D8087-50-HRP 200 µL
DONSON, NT (Protein Downstream Neighbor Of Son, B17, C21orf60) (HRP) discontinued
Sign In for Pricing
View Details FAB8898D 0.1 mL
Mouse Monoclonal Relaxin R1/LGR7 Antibody (933344) [DyLight 350]
Sign In for Pricing
View Details 