EFNB2A, zebrafish (HEK293, His)
The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html
Purity
95.00
Smiles
LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA
Molecular Formula
30219 (Gene_ID) O73874 (L25-A222) (Accession)
Molecular Weight
Approximately 30-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6256556-01 0.1 mL
CD154 (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (MaxLight 750)
Sign In for Pricing
View Details 
MBS6256556-02 5x 0.1 mL
CD154 (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (MaxLight 750)
Sign In for Pricing
View Details GTR15156756 1 Vial
Lentiviral human MAN2B1 shRNA (UAS) - Lentiviral human MAN2B1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details K7147005 3x 1.0 µg
Mapre3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 
MBS7029201-01 0.02 mg
Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11)
Sign In for Pricing
View Details MBS7029201-02 0.1 mg
Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11)
Sign In for Pricing
View Details