Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NEXN shRNA Plasmid
abx987943-01 150 µg

Rat NEXN shRNA Plasmid

Sign In for Pricing
View Details
Rat NEXN shRNA Plasmid
abx987943-02 300 µg

Rat NEXN shRNA Plasmid

Sign In for Pricing
View Details
ARID3B Protein Vector (Human) (pPB-His-MBP)
PV323586 500 ng

ARID3B Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Mouse Mmgt1 Pre-designed siRNA Set A
SI108549A 1 Each

Mouse Mmgt1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
USP26 (Ubiquitin-specific-processing Protease 26, Ubiquitin Carboxyl-terminal Hydrolase 26, Deubiquitinating Enzyme 26, Ubiquitin Thioesterase 26) (MaxLight 650)
MBS6225378-01 0.1 mL

USP26 (Ubiquitin-specific-processing Protease 26, Ubiquitin Carboxyl-terminal Hydrolase 26, Deubiquitinating Enzyme 26, Ubiquitin Thioesterase 26) (MaxLight 650)

Sign In for Pricing
View Details
USP26 (Ubiquitin-specific-processing Protease 26, Ubiquitin Carboxyl-terminal Hydrolase 26, Deubiquitinating Enzyme 26, Ubiquitin Thioesterase 26) (MaxLight 650)
MBS6225378-02 5x 0.1 mL

USP26 (Ubiquitin-specific-processing Protease 26, Ubiquitin Carboxyl-terminal Hydrolase 26, Deubiquitinating Enzyme 26, Ubiquitin Thioesterase 26) (MaxLight 650)

Sign In for Pricing
View Details