Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRR1, Small Subunit Processome Component Homolog (KRR1) ELISA Kit
abx388205 96 Tests

Human KRR1, Small Subunit Processome Component Homolog (KRR1) ELISA Kit

Sign In for Pricing
View Details
Anti-Kv4.2 K+ channel Antibody (K57/1)
RHN20702 100 μg

Anti-Kv4.2 K+ channel Antibody (K57/1)

Sign In for Pricing
View Details
Acetyl-L-Carnitine HCL 98+%
235152-01 100 mg

Acetyl-L-Carnitine HCL 98+%

Sign In for Pricing
View Details
Acetyl-L-Carnitine HCL 98+%
235152-02 250 mg

Acetyl-L-Carnitine HCL 98+%

Sign In for Pricing
View Details
Mouse Monoclonal KLHL2 Antibody (OTI1G7) [Alexa Fluor 750]
NBP2-71695AF750 0.1 mL

Mouse Monoclonal KLHL2 Antibody (OTI1G7) [Alexa Fluor 750]

Sign In for Pricing
View Details
Rat Monoclonal IRAK4 Antibody (413613) [DyLight 488]
FAB39191K 0.1 mL

Rat Monoclonal IRAK4 Antibody (413613) [DyLight 488]

Sign In for Pricing
View Details