Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCOR2, ID (RCOR2, REST corepressor 2) (APC) discontinued
040926-APC 200 µL

RCOR2, ID (RCOR2, REST corepressor 2) (APC) discontinued

Sign In for Pricing
View Details
H6PD Protein Vector (Rat) (pPM-C-His)
PV272189 500 ng

H6PD Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RANK Polyclonal Antibody
ABP60088-01 30 µL

RANK Polyclonal Antibody

Sign In for Pricing
View Details
RANK Polyclonal Antibody
ABP60088-02 100 µL

RANK Polyclonal Antibody

Sign In for Pricing
View Details
RANK Polyclonal Antibody
ABP60088-03 200 µL

RANK Polyclonal Antibody

Sign In for Pricing
View Details
anti-YTHDF2
YF-PA19052 50 ug

anti-YTHDF2

Sign In for Pricing
View Details