Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANO4 3'UTR Luciferase Stable Cell Line
TU000856 1.0 mL

ANO4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ARSF (arylsulfatase F, ASF)
243511 50 µL

ARSF (arylsulfatase F, ASF)

Sign In for Pricing
View Details
CCDC81 siRNA (Human)
CRJ1807-01 15 nmol

CCDC81 siRNA (Human)

Sign In for Pricing
View Details
CCDC81 siRNA (Human)
CRJ1807-02 30 nmol

CCDC81 siRNA (Human)

Sign In for Pricing
View Details
Car4 (NM_007607) Mouse Tagged ORF Clone Lentiviral Particle
MR204282L3V 200 µL

Car4 (NM_007607) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phospho-S6-Ribosomal Protein (Ser240/244) (Clone: CD10) rabbit mAb PE Conjugate
12-4292-100 100 Tests

Phospho-S6-Ribosomal Protein (Ser240/244) (Clone: CD10) rabbit mAb PE Conjugate

Sign In for Pricing
View Details