Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Peptide (306-317) 1mg
A23903-1 1 mg

Tau Peptide (306-317) 1mg

Sign In for Pricing
View Details
PLV3-U6-KHDRBS1-shRNA3-CopGFP-Puro Plasmid
PVT69121 2 µg

PLV3-U6-KHDRBS1-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
DISC1 (NM_001164547) Human Tagged ORF Clone
RG228454 10 µg

DISC1 (NM_001164547) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human hsa-miR-7111-3p miRNA Antagomir
abx887713-01 10 nmol

Human hsa-miR-7111-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-7111-3p miRNA Antagomir
abx887713-02 20 nmol

Human hsa-miR-7111-3p miRNA Antagomir

Sign In for Pricing
View Details
Rufy4 ORF Vector (Mouse) (pORF)
42882014 1.0 µg DNA

Rufy4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details