Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOATZ (NM_001100388) Human Tagged ORF Clone
RG212241 10 µg

HOATZ (NM_001100388) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat ZFAND3 shRNA Plasmid
abx990281-01 150 µg

Rat ZFAND3 shRNA Plasmid

Sign In for Pricing
View Details
Rat ZFAND3 shRNA Plasmid
abx990281-02 300 µg

Rat ZFAND3 shRNA Plasmid

Sign In for Pricing
View Details
GENLISA Human Haptoglobin (Hpt/HP) ELISA
KBH11371 1x 96 Well

GENLISA Human Haptoglobin (Hpt/HP) ELISA

Sign In for Pricing
View Details
GATA4-NKX2-5-IN-1 1mg
A13042-1 1 mg

GATA4-NKX2-5-IN-1 1mg

Sign In for Pricing
View Details
AR CRISPR Activation Plasmid (m)
sc-419181-ACT 20 µg

AR CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details