Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNB2A, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EFNB2A Protein, zebrafish (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/efnb2a-protein-zebrafish-hek293-his.html

Purity

95.00

Smiles

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Molecular Formula

30219 (Gene_ID) O73874 (L25-A222) (Accession)

Molecular Weight

Approximately 30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svs6 (NM_013679) Mouse Tagged ORF Clone
MR218311 10 µg

Svs6 (NM_013679) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Escherichia coli, J5 LPS (E. coli) (APC)
MBS6268757-01 0.1 mL

Escherichia coli, J5 LPS (E. coli) (APC)

Sign In for Pricing
View Details
Escherichia coli, J5 LPS (E. coli) (APC)
MBS6268757-02 5x 0.1 mL

Escherichia coli, J5 LPS (E. coli) (APC)

Sign In for Pricing
View Details
Mouse Endocrine gland vascular endothelial growth factor,EG-VEGF ELISA Kit
CN-02399M2 48T

Mouse Endocrine gland vascular endothelial growth factor,EG-VEGF ELISA Kit

Sign In for Pricing
View Details
PKC alpha Rabbit pAb (APR19933N)
APR19933N-01 50 µL

PKC alpha Rabbit pAb (APR19933N)

Sign In for Pricing
View Details
PKC alpha Rabbit pAb (APR19933N)
APR19933N-02 100 µL

PKC alpha Rabbit pAb (APR19933N)

Sign In for Pricing
View Details